PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g097300.1
Common NameMTR_1g097300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NAC
Protein Properties Length: 572aa    MW: 64727.8 Da    PI: 4.3329
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g097300.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.42.4e-52201462128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      +pGfrFhPtdeelv++yLk+k+ gkkl++ +vike+d+yk++P+dLp +  +k+++++w+fF++rd+ky++g r++rat++gyWkatgkd++v+
  Medtr1g097300.1  20 MPGFRFHPTDEELVMYYLKRKICGKKLKF-NVIKETDVYKWDPEDLPeQsFLKTGDRQWFFFCHRDRKYPNGGRSSRATRHGYWKATGKDRNVI 112
                      69**************************9.99**************95356788999************************************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +++ vg+kktLvfy grap+ge+tdWvmhey++
  Medtr1g097300.1 113 Y-NSRSVGVKKTLVFYLGRAPSGERTDWVMHEYTM 146
                      *.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5815169IPR003441NAC domain
PROSITE profilePS5100553.76919169IPR003441NAC domain
PfamPF023653.8E-2721145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MGAVSESASA DCFSEVMSSM PGFRFHPTDE ELVMYYLKRK ICGKKLKFNV IKETDVYKWD  60
PEDLPEQSFL KTGDRQWFFF CHRDRKYPNG GRSSRATRHG YWKATGKDRN VIYNSRSVGV  120
KKTLVFYLGR APSGERTDWV MHEYTMDEDE LRTCRDVKDY YALYKVFKKS GPGPKNGEQY  180
GAPFKEEEWA DDDVVDFNVN SVDREVPEAA IDNVIDQHQL QPLFDDEIDE IIKGMLDVEP  240
VLDQQHVNGY VDFPQVDDEE TRNVVMDQFY EAMVFPDPSE KQQSSSQLYD AQPSFDFNHQ  300
SVDSHLCISE APEVTSTPNI QSGEGLVFYE EGFLEINDLI DTESTFSNTD KLNNDLIENL  360
QFEDVLSEFD PYQDAEMFLC GLGSINEETV SHAYMNNAGS NIENQSYQLL SNPEDVNQTV  420
DEFWMHVERN TRSPAEGYDG SFSLTNPGVV CDSVGFPTES TENQRSTVED VKTSRLSSAL  480
WAFVDSIPTT PASAAENPLV NRALNRMSSF SRVKIKPTDN NIAAGNNDTA TMKRAGRKGV  540
SFLFFPILIA LCAFLWVSIG NLRLLGRCVS P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-482114617140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.142970.0flower| glandular trichome| leaf| root| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469571.10.0NAC transcription factor-like protein
TrEMBLA0A072VNK60.0A0A072VNK6_MEDTR; NAC transcription factor-like protein
STRINGGLYMA10G36360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-134NAC domain containing protein 17
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]